SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109327 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000109327
Domain Number - Region: 165-228
Classification Level Classification E-value
Superfamily ARM repeat 0.00128
Family PBS lyase HEAT-like repeat 0.084
Further Details:      
 
Domain Number - Region: 24-51
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0412
Family Chromo domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109327   Gene: ENSDARG00000090204   Transcript: ENSDART00000128337
Sequence length 255
Comment pep:novel scaffold:Zv9:Zv9_NA395:33864:34631:-1 gene:ENSDARG00000090204 transcript:ENSDART00000128337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERRNGNLLVQLGPKLQAYPEELIRQRRTHDGQTEYLIRWSLLTVEDSSSSGCSNEAS
GGSGSSSGVGGSSGSTSGESKTESILMWMSTEDVYANCPTLLGKRKADSQRPLLEEEERP
SGQFPADVTFDEGELSDMKDDVKNLVRRARKQMAKNSDFGISITHTIHVLSAYASIGSLV
GVFKETGALDLLMELLCNKERQTRRSAGKMLRALASHDAGKSLLHCLSTVILWIFCSAVF
EWLFPVVLSKTLLTS
Download sequence
Identical sequences ENSDARP00000109327 ENSDARP00000109327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]