SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000109571 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000109571
Domain Number 1 Region: 165-279
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-16
Family Ypt/Rab-GAP domain of gyp1p 0.01
Further Details:      
 
Domain Number 2 Region: 327-437
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 0.0000000000183
Family Cell cycle control phosphatase, catalytic domain 0.055
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000109571
Domain Number - Region: 127-178
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0262
Family Ypt/Rab-GAP domain of gyp1p 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000109571   Gene: ENSDARG00000044357   Transcript: ENSDART00000126524
Sequence length 680
Comment pep:known chromosome:Zv9:6:28629205:28656798:-1 gene:ENSDARG00000044357 transcript:ENSDART00000126524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADAVGEVLEGSWNQDLADALDSAVCDLNSDQDGVIQVRDLSPPQRAKLWMIALNVSGKG
DSLSSWDGVLDLPEQTLIHSRSQQLTDELGIPVEEGRDLVSDVESVITFYCKSRNVTFTP
DLSWPHILKPLLGLQLSRKDLYNCFYAIMNKYIPRDCIVKGRPFHLFRLLLQYHEPEFCS
FLDTKKITPDSYAINWFTCLYSSHCLPEVTQALWDVYLQQADPFLIFFLMLIILVNAKDN
ILIQEGDNKEEIIKMLEQSPSLLEAEDIEDLFSLAQYYNSKTPLSLRKENHNLFGSSLVA
LKEEDMDLSQALCLPVSVPEILQANQLQPEGVRFFVVDCRPAEQYNAGHLSTAFHLDSDL
MLHNPSEFALSVKSLLEAQKQSLESGSVASGEHLCFMGSGREEEDMYMNMVLAHFLQKNK
EFVSIAKGGFMALQQHLADINVEGPDNVYVHWIVSTSGSHSSLSSADGELNSTDGKGVKS
LVNKMTFALKSKSVNVKEKVISFIENTSTPVERHVSSSDRVGKPYRGVKPVFSIGDEEEY
DTDEIDSSSISDDDRKEIVNIQTWINKPDVKHHIPCNEVKETGHMFPSHLLITATHMYCL
REIAARKGFAYIQSRQALNSVVKITSKKKHPELITFKFGNNNAAGVEIVAVERYLIPNAG
DATKVIKQQIMKVLDALESS
Download sequence
Identical sequences ENSDARP00000109571 ENSDARP00000109571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]