SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110031 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110031
Domain Number 1 Region: 5-132
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.2e-29
Family Protein kinases, catalytic subunit 0.0000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110031   Gene: ENSDARG00000090312   Transcript: ENSDART00000131170
Sequence length 144
Comment pep:novel chromosome:Zv9:25:13433477:13434067:-1 gene:ENSDARG00000090312 transcript:ENSDART00000131170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAPGSPSVLQLLDWFDHPRSYVLILECPTPCQDLQSFCEENGCLDEHLANVLHRNIKPEN
LLIDIKLLDFCCGALLKRSAYKYFAGTPAYAPPEWFRRHRYNATPPTVWSVGVTLYNILC
DCFPFRGAQRVTSRSRLTFPRSLS
Download sequence
Identical sequences ENSDARP00000110031 ENSDARP00000110031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]