SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110090 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110090
Domain Number 1 Region: 8-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000244
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 2 Region: 46-89
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000185
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000110090
Domain Number - Region: 82-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.088
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110090   Gene: ENSDARG00000091171   Transcript: ENSDART00000125667
Sequence length 155
Comment pep:known_by_projection chromosome:Zv9:13:38241964:38251948:-1 gene:ENSDARG00000091171 transcript:ENSDART00000125667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDFCEVEMNECCSEPCFNGAICQDLINGYQCHCRPGWTGLHCEDDINECLLQPCNQGMC
IQNEPGHGYTCFCRPGFVGENCEYNYDDCLIQSCPETFSCKDGINNVSCVPVKTDTSSLP
PISVVSWRSTDISTELQPTFAPVENLQHTEQPAGR
Download sequence
Identical sequences ENSDARP00000110090 ENSDARP00000110090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]