SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110256 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110256
Domain Number 1 Region: 79-124,188-308
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.59e-38
Family Ypt/Rab-GAP domain of gyp1p 0.0022
Further Details:      
 
Domain Number 2 Region: 285-440
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-22
Family Ypt/Rab-GAP domain of gyp1p 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110256   Gene: ENSDARG00000088972   Transcript: ENSDART00000122439
Sequence length 472
Comment pep:novel chromosome:Zv9:15:36553744:36574012:-1 gene:ENSDARG00000088972 transcript:ENSDART00000122439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIASCDTSHVEGNCKKLPDSTNGPVGKFKGMKCSLSVGSNGICRSVAPVISPASTCARIT
LPGVMDAEGRVDESRLRTHIFKNGGVSPDERGQVWRFLFSMYPCSSTALERPLLLEQMAV
RYQVMKRKWQQLLPGAVRLRLNGTDAELLTAVKFFDQRQDRELNKQQIQSDETQERLSFL
QLQAQVLFERVTFDLEELQEAIRIIDKDVPRTDRDLPYYRNEGLGNLLVLRDILITYAAF
HPEVSYAQGMNDLCSRFLEVLDSEVDTYWSFSCYMEKFSKDFRADGLYRKMELEAALLKE
LDPQLHSHLVTDNMERLTFCHRWLLLGFQREFEHSDALRLFEILSCDHLELISQQVDCVR
YQERLARKHSLEEEPVADLHAVNTDFTFELFMCATILLENREALLSCKNEVQLIQFTSSL
QGKLDLNATLKKAEELMRNYCKSSSWDYLSGLYRMRKSKEDHFFFHLRNLFS
Download sequence
Identical sequences E7FBH3
ENSDARP00000110256 XP_003200122.1.45394 ENSDARP00000110256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]