SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110385 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110385
Domain Number 1 Region: 50-222
Classification Level Classification E-value
Superfamily PR-1-like 1.03e-53
Family PR-1-like 0.00012
Further Details:      
 
Domain Number 2 Region: 401-504
Classification Level Classification E-value
Superfamily LCCL domain 1.23e-27
Family LCCL domain 0.0014
Further Details:      
 
Domain Number 3 Region: 299-397
Classification Level Classification E-value
Superfamily LCCL domain 1.7e-26
Family LCCL domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110385   Gene: ENSDARG00000013293   Transcript: ENSDART00000129542
Sequence length 509
Comment pep:novel chromosome:Zv9:2:30094482:30110825:1 gene:ENSDARG00000013293 transcript:ENSDART00000129542 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCGHLEDLFSGFVLLVTVQTVVSMVIPNATHLEAILEKYMDKDETWWQSKSRGKRAISQ
SDMQLILDLHNKLRGQVYPPASNMEYMVWDTELERSAEHWAHTCLWEHGPSHLLTRIGQN
LGAHWGRDRPPTFHVQAWYDEVRDFSYPYPQECNPHCPYRCSGPVCTHYTQLVWATSNKI
GCAINVCYNMNVWGMIWAKAVYLVCNYSPPGNWWGHAPYKHGTPCSACPPSYGGGCRNNL
CYKDDGSNYHYTPETEENNYIEPEPEPVRSHDTHYRDETTTPSPNENIERNEVSSTSQMS
QQVACDTRLRDQCKGTTCNRYECPPGCFYNYGKVIGSGHYDMQSSICGSGLHAGIIDDDG
GWLDITRVGRRQRFSKSFKNGVQTLAKNQSANAFTVSNVPVKAVNCETTVAQFCPFKKPV
RHCPRLYCPRNCLYDSYARVIGTRYYADNSSICRAAIHAGVIQSDSGGYVDVMPVDKRKQ
HKGSYQNGISSESLQNPPGGKAFRVFAVI
Download sequence
Identical sequences E7F9U0
XP_009296842.1.45394 ENSDARP00000110385 ENSDARP00000110385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]