SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110793 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110793
Domain Number 1 Region: 104-177
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000733
Family HLH, helix-loop-helix DNA-binding domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110793   Gene: ENSDARG00000087219   Transcript: ENSDART00000127872
Sequence length 256
Comment pep:novel chromosome:Zv9:25:11087304:11088410:-1 gene:ENSDARG00000087219 transcript:ENSDART00000127872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSLKLQRTRNISKNSTMEFNLPPYLLQAAKCKLEPISSVDCGYFSACGSLSPSSSIDSGC
FSPPWGAGRQLEGPENANVDCLQAKKLKLALPVDSKRRSRSKNPGMKRQSASEREKLRMR
DLTKALHHLRSFLPPSVAPAGQTLTKIETLRLAISYISHLSDQLRQAEVPNYEMCCSAEA
SDRFQSGLVFENVCMDGQQGLMQDNVQYCPTLTSFGDSREQMENSFPATSHFRDAQSYMF
PCTTMDDASYSHQFYK
Download sequence
Identical sequences ENSDARP00000110793 ENSDARP00000110793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]