SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000110855 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000110855
Domain Number 1 Region: 162-271
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-37
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 2 Region: 2-113
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-32
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 3 Region: 323-435
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.05e-24
Family Frizzled cysteine-rich domain 0.00037
Further Details:      
 
Domain Number 4 Region: 274-313
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000812
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 5 Region: 120-164
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000110855   Gene: ENSDARG00000087814   Transcript: ENSDART00000131049
Sequence length 437
Comment pep:known_by_projection chromosome:Zv9:15:148682:156045:-1 gene:ENSDARG00000087814 transcript:ENSDART00000131049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TECGGMLSGAGGTLSSPNHPGVYPPDSHCVWVIRVSPPSLVQIQVSSLAIEGPSPCLFDW
LEVREETEKTSAATRFCGNVAPPTLNTNSSTVLVSFHSDGSIGGTGFIAQYHSILPGQRS
CSREEFMCDSGHCLLPVFICDGQPNCQDHSDELNCSHKHRVCGGQITGEYGSLSSPNHPK
PYPHQQMCTWQISVEDGQVIRLSFQNFSLEAQDVCKFDYVEVYDGAETALGRYCGSALPP
DLTSSGPVLTVVFVADEGVADSGFYASFQAISLSERTCSPAQFACPTGECLHQDWLCDGW
SDCADGADEHHCMNSTYPPFTSSCELIQVEMCRDLSYNLTSFPNIWLSLSDQREAASILH
KYRVLVDLPCFESFRQLVCGMFLPRCSPQSGVLQLCQSVCSTAELQCSPALSLFSLNWPF
NCLLLPDSHDPMECSLP
Download sequence
Identical sequences ENSDARP00000110855 ENSDARP00000110855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]