SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111640 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111640
Domain Number 1 Region: 944-1218
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.32e-71
Family Tandem AAA-ATPase domain 0.0000165
Further Details:      
 
Domain Number 2 Region: 692-942
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.64e-55
Family Tandem AAA-ATPase domain 0.0000591
Further Details:      
 
Domain Number 3 Region: 446-493,520-566
Classification Level Classification E-value
Superfamily Chromo domain-like 3.85e-19
Family Chromo domain 0.012
Further Details:      
 
Domain Number 4 Region: 327-399
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.99e-17
Family PHD domain 0.0039
Further Details:      
 
Domain Number 5 Region: 586-658
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000000171
Family Chromo domain 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000111640
Domain Number - Region: 162-202
Classification Level Classification E-value
Superfamily HMG-box 0.00106
Family HMG-box 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111640   Gene: ENSDARG00000063535   Transcript: ENSDART00000130062
Sequence length 1929
Comment pep:known chromosome:Zv9:19:5625088:5683111:-1 gene:ENSDARG00000063535 transcript:ENSDART00000130062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSEDDRDDFEHRSVMQEEDDLEEELSENDAPKVKKKKKAKKSSRESKGSKRNRSRREE
IGISSPEPGEGPDLDDGEEDRSESEGSDYTPGRKKKKRASTAKDKKRNSSAAERNSAASK
RREPEEEEDEDDDDSEPKSSSQLLDTWGMEDIDHIFTEEDYRTLTNYKAFSQFVRPLIAA
KNPKIAVSKMMMVLGAKWREFSTNNPLRGSATSLVAAASVETPPETPTSASAAQISPEST
PAAPVRKAKTKEGKGPNARKKSKPAPKPQEKKVKTKKVAPLKIKLGGFNSKRKRSSSEED
DVDVDSDFDDGSINSVSVSNGSNSRSSRSSAKKKPKKKTKKADEDGDGYETDHQDYCEVC
QQGGEIILCDTCPRAYHMVCLDPDMEKAPEGTWSCPHCEKMGIQWEAREDASEGEEDNEA
GGEAEEDDHHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPEIPNGEWICPRCTCPSM
KGKVQKILTWRWTEPPPPTPVPRPSDLPTDAPDPTPLAGRPEREFFVKWQNMSYWHCSWV
TELQLEIHCQVMFRNYQRKNDMDEPPPIDFGGEGEEEKSDKRKKKDPTYARMEEKYYRFG
IKMEWMVIHRILNHSVDKKNNCHYLIKWRDLTYDQATWELEDMDLPDYDTYKLQYWNHRE
LMMGDEGKPGKKIKIKGKMRKLDRPPENPVVDPTIKFERQPDYLDTTGGTLHPYQLEGLN
WLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIINWEREFE
MWAPDMYVVTYVGDKDSRAVIRENEFSFENNAIRGGKKPSKMKKEASVKFHVLLTSYELI
TIDTAVLGSIDWACLVVDEAHRLKNNQSKFFRILNNYPLQHKLLLTGTPLQNNLEELFHL
LNFLTPERFSNLEGFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSKTELIVR
VELSPMQKKYYKFILTRNFEALNTRGGGNQVSLLNVVMDLKKCCNHPYLFPAAAMEAAKM
PNGMYEGGGLTKSSGKLLLLQKMLRKLKEGGHRVLIFSQMTKMLDLLEDFLENEGYKYER
IDGGITGGMRQEAIDRFNAPGAPQFVFLLSTRAGGLGINLATADTVVIYDSDWNPHNDIQ
AFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGSMSKQEL
DDILKFGTEELFKDEGEGENKEGQEDSSVIHYDDKAIDRLLDRNQDATDDTELQSMNEYL
SSFKVAQYVEEEVQREIIKQEESVDPDYWEKLLRHHYEQQQEDLARNLGKGKRIRKQVNY
NDGSQEDRDWQDDQSDGQSDYSVASEEGDEDFDERSEANSRRPNRKGLRNDKDKPLPPLL
ARVSGNIEVLGFNARQRKAFLNAVMRYGMPPQDAFTTQWLVRDLRGKSEREFKAYVSLFM
RHLCEPGADGAESFADGVPREGLSRQHVLTRIGVMSLIRKKVQEFEHVNGQWSMPWMMEL
SENKTTSTAGSHPDSPSKTPTTGTPSDTQPNTPAPDGVPKAEDAGKDADKEKVKNGDGEK
EANENKNSEVIAVPDEDGRAASASEEKEKGKEEKEKTPESSSEAEKADGKQEEKEEENAK
SGDSEEKTDDTDKPKGSEADKETSDAKGEKKDDEPEKMDTTPVTDEKKGQKDEKDSGKTE
EAGKLPNGESAKDSAAGAGIEERKKAKTRFMFNIADGGFTELHSLWQNEERAATVTKKTN
EIWHRRHDYWLLAGIIQYLLMQHGYARWQDIQNDVRFAILNEPFKGEINRGNFLEIKNKF
LARRFKLLEQALVIEEQLRRAAYLNMTEDPSHPSMALNTRFSEVECLAESHQHLSKESMS
GNKPANAVLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGP
DTQSQQVQQ
Download sequence
Identical sequences Q1LYP4
NP_001038323.1.45394 ENSDARP00000111640 7955.ENSDARP00000087355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]