SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000111725 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000111725
Domain Number 1 Region: 1-67
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000366
Family HLH, helix-loop-helix DNA-binding domain 0.00006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000111725   Gene: ENSDARG00000032039   Transcript: ENSDART00000127030
Sequence length 160
Comment pep:known chromosome:Zv9:5:14913007:14926642:-1 gene:ENSDARG00000032039 transcript:ENSDART00000127030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAHLRLCLERLKSLVPLGPESNRHTTLSLLMRAKEHIKRLEDSERKAQHTIDQLQREQR
HLRRRLEQLGVERTRMDSMGSTISSDKSDSDQAMLRVIVQEEVDVDVEGTDYLLGDLEWS
TSSVSDSDERGSLRSSCSDEGYSSASLRRLANSQENSLVL
Download sequence
Identical sequences ENSDARP00000111725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]