SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112937 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112937
Domain Number 1 Region: 3-84
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.27e-19
Family THAP domain 0.00086
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000112937
Domain Number - Region: 117-162
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 0.000222
Family Oxysterol-binding protein 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112937   Gene: ENSDARG00000093833   Transcript: ENSDART00000134976
Sequence length 283
Comment pep:putative chromosome:Zv9:2:27534787:27539728:1 gene:ENSDARG00000093833 transcript:ENSDART00000134976 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCSAPNCSNSTTIGKQLFRFPKDPVRMRKWLVNCRRDFVPTPCSRLCQDHFEESQFEE
IARSPAGGRKLKPNAIPTLFNVPDPPSPVTPQAVLPVKNEPVEKELNMGDHGYARRQPPV
DSEEDGVQRAEEEQPCSLCQHYKTKLEQQQQHTVRLQREAEEMKKRLYKLSKIEKGLQVF
LFEDQIRALTLAKRSRRAVWSHDTLLTARKIRCAVGVKGYEYLRELGYPLPSYRTLCNRL
EPKMMVSTSMQDELAELGLGIIAACDSPEGNMTSDEGLIGVMT
Download sequence
Identical sequences E9QCV3
ENSDARP00000112937 ENSDARP00000112937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]