SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000112985 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000112985
Domain Number 1 Region: 1-84,123-177
Classification Level Classification E-value
Superfamily Chromo domain-like 2.07e-34
Family Chromo barrel domain 0.000023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000112985   Gene: ENSDARG00000041155   Transcript: ENSDART00000139441
Sequence length 323
Comment pep:known chromosome:Zv9:18:19814734:19826018:1 gene:ENSDARG00000041155 transcript:ENSDART00000139441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKINIKDKQVKYFIHYSGWNKNWDEWVPES
RVLKYVDSNLQKQKELQKANQDHYVEGRMRGVAPSKKIAAVQQKNVDVKTKKNKQKTPGA
GEGTSTGDMPHPPRKKRARVDPTVESEETFINRVEVKVKIPEELKPWLVDDWDLITRQKQ
LFHLPAKKNVDAVLEDYANYKKSRGNSDNKEYAVNEVVAGIREYFNVMLGTQLLYKFERP
QYAEILANHPDTSMSQIYGAPHLLRLFVRIGAMLAYTPLDEKSLALLLSYLQDFLKYLVK
NSSSLFSASDYEVAPPEYHRKAV
Download sequence
Identical sequences A8E7S8
NP_001002604.2.45394 7955.ENSDARP00000060318 ENSDARP00000112985 ENSDARP00000112985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]