SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113718 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113718
Domain Number 1 Region: 181-383
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.91e-51
Family Ypt/Rab-GAP domain of gyp1p 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113718   Gene: ENSDARG00000026988   Transcript: ENSDART00000132253
Sequence length 418
Comment pep:novel chromosome:Zv9:8:10805411:10879501:-1 gene:ENSDARG00000026988 transcript:ENSDART00000132253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATDNRIHFWRKNPKVPGRLKDTPKASSVVKSKKPSTFHEFARSTNDAWDIDDEEDDGIF
SLKQSSSSPVQSRSTPQTPCLKLFKVPDDTELGTRSLDRQEPISTNPDQERLDVESGPAN
GRVVKSCSDAQLNVNTARNPLQKQQSLPVRPVIPLVARISDQNASGAPPMTVREKTRLDK
FKQLLSSSNTDLEELRKHSWSGIPREVRPVTWRLLSGYLPANRERRDLVLQRKREEYFGF
IEQYYHSRTDENHRDTYRQIHIDIPRTNPLIPLFQQPLVQEVFERILFIWAIRHPASGYV
QGINDLVTPFFVVFLSEFVEEDVENFEMASLPLDTQRNIEADSFWCMSKLLDGIQDNYTF
AQPGIQIKVKALEELVSRIDGKIIFTNTSTIAVHSAYSSRQLYLFSFVYLRTEKLHFK
Download sequence
Identical sequences E9QIC7
ENSDARP00000113718 ENSDARP00000113718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]