SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000113836 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000113836
Domain Number 1 Region: 41-106
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000017
Family Chaperone J-domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000113836
Domain Number - Region: 3-45
Classification Level Classification E-value
Superfamily TPR-like 0.0436
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000113836   Gene: ENSDARG00000039363   Transcript: ENSDART00000136622
Sequence length 233
Comment pep:novel chromosome:Zv9:13:30259044:30266939:1 gene:ENSDARG00000039363 transcript:ENSDART00000136622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSNKDEADRCIEIAIAALRDNEQDKARRFLEKAQRLFPTDKARSIGNAYAVLSNPEKRR
QYDVYGEEKAHPTHRHRTYHRNFEADISPEDLFNMFFGGGFPTSNVHVYSNGRMRFGHQQ
RHERQEQQREGGLALFVQLMPILILIIVSALSQMMVSSPPYSLSHRPSLGHTSRRQTATL
KVPYYVGDHFSEEYKGMNLKNVEQSVEEDYISNLRNNCWKEKQQKEGLLYRAR
Download sequence
Identical sequences B7ZD52
ENSDARP00000113836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]