SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114090 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114090
Domain Number 1 Region: 28-199
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.83e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114090   Gene: ENSDARG00000075156   Transcript: ENSDART00000147813
Sequence length 202
Comment pep:known_by_projection chromosome:Zv9:9:31659724:31666562:1 gene:ENSDARG00000075156 transcript:ENSDART00000147813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLDYQEVCSCSKELQALWDRKLSSPCRTKVQWNKEEIHSAVCQGVPKSRRGEVWLLLSQ
QHRLRQRLPHRQQPPETPFQDLLKQLTAQQHAILVDLGRTFPTHQYFSAQLGAGQLSLYN
LLKAYSLLDTEVGYCQGISFVAGLLLLHMSEEQSFDTLKFLMYDLGIRRQYRPDMISLQI
QMYQLSRLLHDYHRNLYSHLDE
Download sequence
Identical sequences E9QC96
ENSDARP00000114090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]