SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000114372 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000114372
Domain Number 1 Region: 1235-1542
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-66
Family Tandem AAA-ATPase domain 0.0000593
Further Details:      
 
Domain Number 2 Region: 960-1233
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.79e-60
Family Tandem AAA-ATPase domain 0.0000561
Further Details:      
 
Domain Number 3 Region: 2729-2813
Classification Level Classification E-value
Superfamily BRK domain-like 1.83e-26
Family BRK domain-like 0.00000665
Further Details:      
 
Domain Number 4 Region: 828-909
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000196
Family Chromo domain 0.024
Further Details:      
 
Domain Number 5 Region: 921-980
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000381
Family Chromo domain 0.0044
Further Details:      
 
Domain Number 6 Region: 2679-2718
Classification Level Classification E-value
Superfamily BRK domain-like 0.000000144
Family BRK domain-like 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000114372   Gene: ENSDARG00000075211   Transcript: ENSDART00000135230
Sequence length 3140
Comment pep:novel chromosome:Zv9:2:21562193:21617220:-1 gene:ENSDARG00000075211 transcript:ENSDART00000135230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPGMMSLFGDDGNLFSDELEGLGDCGYPQGQTNPMSQQMPHEHQGYGQLPPSLHLSSP
AVPGQAKLGHHFDPFNQYEQPKMHPMDQQGGRMMGNGPVNGMSSPHSRYHGAQAGAGGAA
GHHVYPGAQGDGRSQSFPDSGNTWGAQPMQVPEQTRPPFQQQPPQASSHQHGPAGPQGHA
HQMGPFIGRGDYAIQGHNQTQTPPRMNHFPQGLPQEANHFLGHVGMTQNPGMSGPPIRHL
AQPSQQHQQPNQQFLHRPGQGPVHPDSVASHNPQFPQSPSRQQQQQQQVMGGRPHQNMGF
NMHNQQVPSNTVNSSGQYPPYSSYGNLNQGLANTSGMSPNLSLTTSSNSNPNAPVTQVQR
YPAPAGPQRYPTPGGQQGPLHQQPIHVNQINTQPMHPAQNQATAQPKLQQHLPPPPQGSY
SSPPSMSPMRNLATPAGTPPPQQVRPPSAGLATDVGGYPGVPHQSQGPMAHAQRGAGPMN
AAQPLPHQQLPSHSTHPHPPTTQMYAALSPNHRATAAQGRSSTTPGGNHTEPPGPQDQRL
HAQQAQCQQLQKPPLPFQQQQLQQVHTPPSIPPSQTHLAAHHQSSPPSQQAWAPTHQSPP
PMQKVPHMLHSPPDPSLEIITSSKTPAMGPNLQPANCDLQQKESELKPKKKKKKKAKVSE
GQECNNISSEAGGEVTALMNEGDSLITPVEKPAEKKSKKKPKEKEPKEPKEPKTPKTPKT
PKTPKEPKEPKEKKVKTATPKPKSSKKPSAKKSDSESGNSTKKEAKRKREPSVTSDVEKT
PPQSPEEEDDDGVQKRRSSRQVKRKRYTEDLEFRISDDDDGDDSAGPKSPTTSEQQELPD
AEGPVVEKIMGMRMGKKELASGEEIEVEEFYVKFKGFSYLHCRWADIEELEKDKRIQQKI
KRFRAKQALSTFVTEMDDEPFNPDYVEVDRVLDVSESTDENGELVTLYLVKWCSLPYEDS
TWELKADIDQVKIEEFERVMAREPQLKRVERPPTSDWQKSESSREYKNANALREYQLEGV
NWLLFNWYNTRNCILADEMGLGKTIQSITFLYEIYLKGIHGPFLVIAPLSTIPNWEREFR
TWTELNVVVYHGSQASRKTIQAYEMYYRDTQGRIIKGAYKFHAVITTFEMILTDCPELRN
VPWRCVIIDEAHRLKNRNCKLLEGLKMMDMEHKVLLTGTPLQNTVEELFSLLNFLEPDRF
PSESTFMQEFGDLKTEEQVQKLQGILKPMMLRRLKEDVEKNLAPKEETIIEVELTNVQKK
YYRAILEKNFAFLSKSGAGGGSGGGGGSNVPNLLNTMMELRKCCNHPYLINGAEEKIMEE
FRETHPLDQPEFHLQAMIQAAGKLVLIDKLLPKLKAGGHRVLIFSQMVRCLDILEDYLIQ
RRYPYERIDGRVRGNLRQAAIDRFSRPDSDRFVFLLCTRAGGLGINLTAADTCIIFDSDW
NPQNDLQAQARCHRIGQSKSVKIYRLITRNSYEREMFDKASLKLGLDKAVLQSMSGRENA
ANGVQQLSKKEIEDLLRKGAYGALMEEEDEGSKFCEEDIDQILQRRTQTITIESEGKGST
FAKASFVSAGNRTDISLEDPDFWQKWAKKAELDLDAINGRNNLVIDTPRVRKQTRHYSSM
KEDDLMEYSELESDSEDKPIQKPRRPQDRTQGYPRSECFRVEKNLLVYGWGRWGDILSHG
RFKRPLRERDVETICRALLAYCLLHYRGDENIKGFIWDLITPTEDGQSRTLTNHSGLSAP
VPRGRKGKKGKLPVAQTRMPQADWLADCNPDLLLQEDSYKRHLKHHCNKVLLRVRMLYYL
RQEVIGDQADRILEGTDSSELDIWIPQPFHADVPTDWWDLDADKSLLIGVFKHGYEKYNS
MRADPTLCFLERVGMPDAKAIAAEQRGADMMADGVEGEEEDPEYKPLRMSFKDDLDDFTN
SPLDDNNDGMDGETGEAPKLGENGKPGNLYWPPASALTARLRRLITAYQRTHKREQLRQE
AMAKPDRRRRRPRDDILAMVTEGGAYVPDGAVAFMADGGAFMAKGSPFIPDSAALLADSA
AYFKERRQRWTRREEADFYRVVSTFGVVYDVHRQCFDWSQFRAFARLDKKTDESLEKYYC
SFVAMCKRVCRMPLKSETELPDPTIIIDPITEERASRTLYRIELLRRIREQVLPHPLLEE
RLSLCQPSPDLPAWWEPGRHDRDLLRGAAKHGVSRTDYHILNDPELSFLEAYRKFTQGKG
VELPVIVSDPLTPLTLPKDEEVKEEQGDVTLPKVENGSIEDVKEEKSEALSPKKEVKNEE
DENGLGPKQEPKEEKMEVEEKDVTEFKTDVEQVCPVDGMVEKKPMDQEPTDTLPSSEDKN
AQDEKELPTGNKLSTEKASEDEEEKMDEDDKSEKSSQAEVGALSERKNFDEESNASLSTA
RDETNETRDCFSVDDVEPSASQMFSERSLFSFWPKDRVMINRMDNICEAVMKGKWPSNRR
QFFDFPGLLPGYSSMATESPLQRRSLGDLSLVGQTSYSGSEDLTMSPQVNKDDALSLSVP
RQRRRRRRKIEIEAERAAKRRNLMEMVAQLRESHAEGQAQAIDLTKALHSVSSSSSASAF
PGAMASSATLKAQMELLQPGASSRPRANGSLLDTELPNRRKRGRRKNVEGLELLFMGNKR
GQLSAELSDGTKAFVDGRTHLAMPSPAQKASGEGLDEGSLQGEDGSSTKDLREWLRQHPT
YTMDMPGYVPKNEDLLLSQFAKPKQKRHRCRNPNKIDINTLTGEERVPVVNIRNGRKMGG
AMAPPMKDLPRWLVENPEYAIAPDWTDIVKQSGFLPESMFDRLLTGPVVREEGVRRRGRR
PKAEIAKATAAAQAAAAAAAAATTSGVNPLLMNGLFGSMDLTSLQGLQNLQSLQLAAGLM
GFPTALGGGADAKHAAAMLPLMLPGMGGLPNMFSLGSLFGGNLAAAATATNGASSTEQAE
SEENSKPKTDEETKGEGDEKEEKQAEKSSETVESADATGDAAALNAAAAAAAAGMSTGTL
AFNPFLLSTMAPGLFYPSMFLPPSLGGLAIPGFPQASLADLQSAVSGALGATGEDKESDK
GPRTNQDPNASVADVETADNTLEDSDSEESQNKTADSSVLDDDLAGPAEEMDSMEGGMDD
EDDDDDDDDDDPADEDDKSD
Download sequence
Identical sequences F1QGL1
ENSDARP00000011638 ENSDARP00000011638 ENSDARP00000114372 XP_697956.4.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]