SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115027 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115027
Domain Number 1 Region: 487-659
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.33e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 2 Region: 641-738
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-17
Family Ypt/Rab-GAP domain of gyp1p 0.03
Further Details:      
 
Domain Number 3 Region: 806-937
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000162
Family Calmodulin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115027   Gene: ENSDARG00000059900   Transcript: ENSDART00000143909
Sequence length 1248
Comment pep:known chromosome:Zv9:1:53817569:53856799:1 gene:ENSDARG00000059900 transcript:ENSDART00000143909 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVNPEEVLLASALWMTERANPYFVLQKRKGHGDGGGGLAGLLVGTLDVVLDSSARVAPY
RILYQTPDSLVYWTIAHGSSRKEITENWEWLEQNLLQTLSIFENENDITTFVKGKIQGII
AEYNKSHDIKEDDDTDKFKEAIAKFRKLFVMPEEEKLVNYYSCSYWKGKVPRQGWLYLSI
NHICFYSYLLGKEVKLVVRWADVTQLEKSATLLLPDMVRVSTRCSEHVFSVFLNINETFK
LMEQLANIAMRQLLDNKGFEQDRSLPKLKKKSPKKVSALKRDLDARAKSERYRALFRLPK
DEKLDGHTDCTLWTPFNKMHILGQMFVSTNYICFTSKEETVCSLIIPLREVTIVEKADSS
NVLPSPLSISTKNKMTFLFANLKDRDFLVQRISDFLQQTTSKIYFEREITGSLSSSDDEV
YSQQGSVLSCSPQRSALVSEGESERQFNLNDNRVPTATQALMTMYRRRSPEEFNPKLAKE
FLKEQAWKNHFTEYGQGVCMYRTDKTKDLVLQGIPENMRGELWLLFSGAINEMATHPGYY
EDLVEKSMGKYNLATEEIERDLHRSLPEHPAFQNEMGIAALRRVLTAYAFRNPNIGYCQA
MNIVTSVLLLYAKEEEAFWLLVAMCERMLPDYYNTRVVGALVDQGVFEELAHVHVPQLYD
CMQALGVISTISLSWFLTLFLSVMPFESAVVVVDCFFYEGIKVIFQLALSVLDANIHQLL
GCKDDGEAMTILGRYLDSVTNKDSTLPPIPHLHSLLTDNGEPHPEVDIFKLVRSSYEKFG
SIRADVIEQMRFKQRLRVIQAIEDTTKRNVVRTIVTETPFSIDELEELYSLFKAEHLTSC
YWGSSSNPMSRHDPSLPYLEQYRIDLEQFKGLFTLLFPWACGSHADDLAFRFFRLLDHNT
DALINFREFISGLSVLCHGDLTEKLKFLYKIHILPELHHEQEEPDSACEATQYFFEDITP
ETSSGLDHKSRSEKDDGFVRVTFKNEKVKKTHTADYRTYLRLWNQETKAKLENMKDLPKL
NQSQFIELCKTLYNMFSEDPNEQELYHATATVTSLLLEMGEVGKLFCTPASKHNNEDDDE
EEDERSIPTCRNKQDRPHRKPCDITPPLDEIKLEDSSPKDTATSSAMLISDDETKDDTSM
SSYSVLSAGSHELDDKLQCEDIADDTVLIRNGGAGHHGRSGLPHSASIDKDWAITFEQFL
ASVLTEQALVQYFEKPVDVAGRITNAKNVRKVGHQHMSVSDYEISLSG
Download sequence
Identical sequences F1Q7J9
XP_692034.2.45394 ENSDARP00000115027 ENSDARP00000115027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]