SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115557 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115557
Domain Number 1 Region: 131-193
Classification Level Classification E-value
Superfamily Chromo domain-like 5.15e-26
Family Chromo domain 0.000045
Further Details:      
 
Domain Number 2 Region: 16-73
Classification Level Classification E-value
Superfamily Chromo domain-like 2.75e-21
Family Chromo domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115557   Gene: ENSDARG00000061187   Transcript: ENSDART00000143340
Sequence length 204
Comment pep:known chromosome:Zv9:23:36348765:36357900:-1 gene:ENSDARG00000061187 transcript:ENSDART00000143340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKSQNREDDEAASSDEEEYVVEKVLDRRVVKGRVEYFLKWKGFTEKHNTWEPEKNLDC
PELISEFMKTYKKGNSASPPSSKSSSTGPSSARPKDSSGSSSTSKRKNSEEENGSSSKPK
KKKEDEILVARGFERGLEPEKIIGATDSCGDLMFLMKWKDSDEADLVLAKEANHKCPQIV
IAFYEERLTWHEDGDKKEKSATAV
Download sequence
Identical sequences A1L223
7955.ENSDARP00000081419 ENSDARP00000081419 ENSDARP00000115557 ENSDARP00000120917 ENSDARP00000081419 NP_001073653.1.45394 XP_021325495.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]