SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115633 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115633
Domain Number 1 Region: 79-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115633   Gene: ENSDARG00000035695   Transcript: ENSDART00000145363
Sequence length 199
Comment pep:known chromosome:Zv9:19:3564002:3572099:1 gene:ENSDARG00000035695 transcript:ENSDART00000145363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRPAPSRYVYSDISMMSEDDENGSESSGSDDRSFHLDTSGYDLKVGRKRKSSVGGGGRL
IGVTPTIPTGTIGHVPEIRQRNAANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIET
LRLASSYISHLGNVLLVGEACGDGQPCHSGGPSTSNYYHHHGSPSRDSENSQPKQICTFC
LSNQRKMSKDRERKSALRS
Download sequence
Identical sequences Q1LXV2
ENSDARP00000115633 7955.ENSDARP00000095963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]