SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000115643 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000115643
Domain Number 1 Region: 11-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.45e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000115643   Gene: ENSDARG00000024844   Transcript: ENSDART00000139843
Sequence length 129
Comment pep:novel chromosome:Zv9:20:28859853:28868432:-1 gene:ENSDARG00000024844 transcript:ENSDART00000139843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDNDDIEVDSDADKRAHHNALERKRRDHIKDSFHSLRDSVPALQGEKQSIKQASRAQIL
DKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQESQRDHAASGQLLVFRQQPVHQPQGQ
RRVGLRRRV
Download sequence
Identical sequences Q5SPG4
ENSDARP00000115643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]