SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117183 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117183
Domain Number 1 Region: 475-597
Classification Level Classification E-value
Superfamily Bromodomain 5.23e-30
Family Bromodomain 0.00051
Further Details:      
 
Domain Number 2 Region: 612-734
Classification Level Classification E-value
Superfamily Bromodomain 1.96e-29
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 3 Region: 179-291
Classification Level Classification E-value
Superfamily Bromodomain 3.14e-29
Family Bromodomain 0.00085
Further Details:      
 
Domain Number 4 Region: 24-155
Classification Level Classification E-value
Superfamily Bromodomain 4.97e-28
Family Bromodomain 0.0011
Further Details:      
 
Domain Number 5 Region: 369-460
Classification Level Classification E-value
Superfamily Bromodomain 7.06e-28
Family Bromodomain 0.00059
Further Details:      
 
Domain Number 6 Region: 1327-1408
Classification Level Classification E-value
Superfamily HMG-box 2.36e-17
Family HMG-box 0.0009
Further Details:      
 
Domain Number 7 Region: 789-854
Classification Level Classification E-value
Superfamily Bromodomain 0.000000000628
Family Bromodomain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117183   Gene: ENSDARG00000077038   Transcript: ENSDART00000132845
Sequence length 1575
Comment pep:novel chromosome:Zv9:6:46343751:46368781:1 gene:ENSDARG00000077038 transcript:ENSDART00000132845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSKRRRATSPSSSASGGDFDDASSSTPVSGWKRRRASNAPSVDQIAVCHELYNTVRDYK
DDQGRQICELFVRAPKRRNQPDYYEIVSQPIDMMKIQQKLRAEEYQDVEQFSADFHLLIN
NTKAYYQADSAEHRAASKLLNVFLSAKNELLQGGDGEEAEDDEESEDAENTNASMEEERP
PSYLKAILEQLLEAIASCTDSSGRLVSELFQKLPSKLHYPDYYAVIKEPIDLRAVAQKIQ
GGHYKSISAMAKDIDLLVKNAKTYNEPGSQVFKDANTIKKVFAQRKIEIEQAEPTKTSLR
IRNRRSAQGDRLSAITMALQAGSESDEDSILTGTVRYDTGETEADCGLSAGDPILLLYQA
VRGARSVQGLLLSEPFLQLPSRREYPDYYHQIKNPISLQQIREKMKNGDYEAVEQIEADL
SVMFENARRYNMPNSTIYKRAQRLQLIMQQKKREFRDDDEGDVSTANSDVGSSKKKSHKK
SAKKNRMKMLYAVLTDAREPGSGRRLCDLFMVKPLKKDYPDYYKIIQDPMDMRTIENNIR
TERYNNEDALMEDMKLMFRNARHYNEEGSQVYNDANVLEKMVKDKQKELGPAPEEDDVGS
PKLKLRRSGVAVSPKKARIQTTPLQQKLSELYEAVRNFTDNRGRRLSTVFLRLPSRSELP
DYYAAIKRPIDMERIRSYMVQGRYQDVDSLAEDFILMFNNACTYNEPESLIYRDALLLHR
AFLEARRRIEEEENGDEGGLGGLSVASLVRELIRNLFVSMMGHQDDEGRCYSDSLAEVPA
IDPANPDDPPLTLEIIRNNVDSGRYRRLDVFQEHVFEVLEKARRLNRTDSEIFEDSVELQ
HFFVKIRDELCKNGEILLTPALSYTSKHLHSDIDQEKREKLPQEIEEDQLKREEDKKALP
EGDKAEGPAEGGQWPSGSQSSYSQDCSFENNTYSIGDYVYVQPAEANLQPHVVCIEKLWK
DESGQQWMYGCWFYRPEETFHLATRKFLEKEIFKSDYNNRVPFSKILGKCFVLFVKDYFK
LQPEGFKPEDVYVCESRYTVRTKAFKKIKIWSMPPNSVKLLPREVPLPVVRVASMFVGAK
DKAADLPDGESGGFIEKEREDVPVEVPNGELGCQYYEQLRYNDMWLKLGDCVYIRSHGLV
RPRVGRIEKMWLRDGAAFFFGPIFIHPEETEHEPTKMFYKREVFLSSLEENCPMTCVLRK
CVVSSFKDFLSCRPTECPEEDVLLFESRYIESEKQMKKFKALKRFSLSAKVVDDEIFYFR
KPIVPQKVPSPLLDKKIEELEAKFADMEDLDDDMDDLDDDDEEAAATPSMPPSQASTTSD
MDMPYTPPQSTPKIKGMSKKEGAKRKINMSGYILFSSEVRSLIKARHPDFSFGELSRLVG
TEWRNLEATKKAEYEERAAKLVEQQERERVLQQQHQQQQQQQQQQQQQASPRAGVMVPGM
NGSPGPGNPYGMQMAGYGPGQQAPPPYPGQGQPGHQQPAPPIFVAPPPKPQRLLHSEAYL
KYIEGLSAESSTVSKWDQSLKAQRKDCRLSREQESHLPTHWLKSKGAHTTMADALWRLRD
LMMKDTLNIRQAYNL
Download sequence
Identical sequences F1QPX8
ENSDARP00000117183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]