SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000117904 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000117904
Domain Number 1 Region: 176-213
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000001
Family HLH, helix-loop-helix DNA-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000117904   Gene: ENSDARG00000041689   Transcript: ENSDART00000143990
Sequence length 213
Comment pep:putative chromosome:Zv9:15:20214228:20219966:1 gene:ENSDARG00000041689 transcript:ENSDART00000143990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGQPKSSEPDVSVPVIEEVATAEDPSAITTIQSASTFSTDQPIKYLFKTEGAGGQVGEL
YPPSGQVTYRVIQVADGQLEAQPDGTTAVSVVTGFPATTQPVTQAVFSQSEGLEGDGTET
HYTYYPATISDATAGTMVTGVQASDALLSQSASAGQLYVMMSPQEVLTGANQSKSEGPRT
SRDEKRRAQHNEVERRRRDKINNWIVQLSKTIP
Download sequence
Identical sequences E9QEC7
ENSDARP00000117904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]