SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118656 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118656
Domain Number 1 Region: 135-200
Classification Level Classification E-value
Superfamily Chromo domain-like 2.23e-27
Family Chromo domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 41-102
Classification Level Classification E-value
Superfamily Chromo domain-like 2.03e-22
Family Chromo domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118656   Gene: ENSDARG00000004189   Transcript: ENSDART00000143088
Sequence length 212
Comment pep:known chromosome:Zv9:3:24351695:24362823:1 gene:ENSDARG00000004189 transcript:ENSDART00000143088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMSQPTETVSDAPSVTEEVSPDSKLAATAGKKQTKKKVEDVVEEEEEEYVVEKVLDRRV
VKGRVEYLLKWKGFSEEDNTWEPEDNLDCPDLIAEYMTKHKINDDKKESSAKRKESDTDG
GGEDSRPKKRKDEQDKPRGFARGLDPERIIGATDSSGELMFLMKWKNSDEADLVPAKEAN
VKCPQVVISFYEERLTWHSYPSEEEEKKDDKN
Download sequence
Identical sequences F1QM86
ENSDARP00000118656 ENSDARP00000118656 NP_956040.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]