SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118664 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118664
Domain Number 1 Region: 82-128
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000000000102
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 16-73
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000276
Family HLH, helix-loop-helix DNA-binding domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118664   Gene: ENSDARG00000019335   Transcript: ENSDART00000141495
Sequence length 161
Comment pep:known chromosome:Zv9:2:48402633:48418192:1 gene:ENSDARG00000019335 transcript:ENSDART00000141495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPASRSNTHDEDYYGIKDRKTRKPLVEKKRRARINESLQELRLLLADPDAQVKMENAEV
LEMTVKRVESILQNKAKEADSVNREANERFAAGYIQCMHEVHTFVSSCPGIDATIAADLL
NHLLECMPLNDEERFQDILSDLISDSNNSGTWPGEAAYATL
Download sequence
Identical sequences E9QI80
ENSDARP00000118664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]