SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118716 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118716
Domain Number 1 Region: 221-375
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-45
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 18-77
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000259
Family B-box zinc-binding domain 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000118716
Domain Number - Region: 61-170
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00248
Family Apolipoprotein A-I 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118716   Gene: ENSDARG00000039108   Transcript: ENSDART00000138588
Sequence length 385
Comment pep:known_by_projection chromosome:Zv9:3:8865753:8869914:-1 gene:ENSDARG00000039108 transcript:ENSDART00000138588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSLKLKQKVKMDPVAVGDPACALHSEKLQLFCLEDKQLACLVCRDSEKHVSHTFRPIA
EAVSSYKEELKTTLKSLQFKLTQELKTRGELEKTVQHIKSQADHTLHQIQHEFKKLHQFL
RDEEEATITALREEEEQKKQKMKEKLEEMNTHISALSQTIKNTEEMLKANDVCFLKEFPV
SMERVQISQPDPQTPSGALIHVSRYLGNLPFRVWKKMQDIVHYTPVILDPNTANPHLVLS
DDLTSLRDSFLNSKPLPDNPERFDYYSCVLGSEGLNSGKHRWDVEVKKCSIWSLGLTTAS
NQRKGRDFFNTGVWCVSFGLYEPSGFIVKQSLERVRVDLDCDRGTVSFSDPVTNTHLHTF
TTTLTESVFPFFCSIYQLRILPFRS
Download sequence
Identical sequences F1QKR8
ENSDARP00000118716 ENSDARP00000118716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]