SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118812 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118812
Domain Number 1 Region: 170-211
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118812   Gene: ENSDARG00000014463   Transcript: ENSDART00000146963
Sequence length 212
Comment pep:known chromosome:Zv9:5:31441918:31450801:1 gene:ENSDARG00000014463 transcript:ENSDART00000146963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKRKGSDPEDSPILQDGVADTTDDSLAVTAIQSAAAFSTDQQIKYHFLKAEATGGQVTY
RVIHLADGQVEGHADGAAAVSVVTGFPTATQAATPPTVMSESVEGETSETQYYYPATLSD
TTAGAMVTGLQTADSVLSQPTSAGQLYVMMSPQDVLATTQPSKPGSQRVSRDDKRRAQHN
EVERRRRDKINQWIVQLSKTIPDCTYDAKNNQ
Download sequence
Identical sequences F6NL66
ENSDARP00000118812 ENSDARP00000118969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]