SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118843 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118843
Domain Number 1 Region: 91-155
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000062
Family PHD domain 0.0091
Further Details:      
 
Domain Number 2 Region: 38-88
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000000373
Family Tudor domain 0.008
Further Details:      
 
Domain Number 3 Region: 185-256
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000144
Family PHD domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000118843
Domain Number - Region: 539-560
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0393
Family Chromo domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118843   Gene: ENSDARG00000078050   Transcript: ENSDART00000142150
Sequence length 562
Comment pep:novel chromosome:Zv9:8:12857779:12920609:-1 gene:ENSDARG00000078050 transcript:ENSDART00000142150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLESACRDGYLTAGSESLEPKHLHPNIEKSICDQETSLTVGQYVLCCWSDGLYYLGKIQR
VSTSKQSCFVSFEDNSKFWVLWKDIQHAGIPGEEPKCSVCSDMSLDPGNEILICGKCGVG
FHQLCHLPTVESSADPSPWFCRRCIFALAVRKGGALKKGQLAKDLQAMKQVLTYNPEELE
WDSLHRTNHQQCYCYCGGPGWYLKMLQCFRCEQWFHEACTQCLQDSMMFGDRFYLFICAV
CNKGVEYIKRLALRWVDVVHLALYNLGVQSKKKYFELEEIVAFINNNWDRFQMGKLSNTP
LPERGQLILDALNNYKSKFLCGKEIKKRKCIFRLRTRVPPNPPSKLYPEKAQKSDAHRGR
KKAVSRSSNSDPAEKRRKKRAKWLLEDAIPNNDLTSSWSTNHHMANIFDFTLDELQSLKS
TSSGQTFSLDQDSTDAASTSGSATTSVSYDFRKNVGSRKRKLPTSNYNLLATKRELVERE
PSPINMPGEERNVLMENGIDSHTFESISEDDSSLLHLKSSITSYFGAAGRLTCGEKYQVL
ARRITPEGKVQYLVEWEGTTPY
Download sequence
Identical sequences B0UXK0
ENSDARP00000118843 NP_001121998.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]