SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000118990 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000118990
Domain Number 1 Region: 551-755
Classification Level Classification E-value
Superfamily vWA-like 3.27e-55
Family Integrin A (or I) domain 0.00025
Further Details:      
 
Domain Number 2 Region: 372-565
Classification Level Classification E-value
Superfamily vWA-like 9.56e-44
Family Integrin A (or I) domain 0.00066
Further Details:      
 
Domain Number 3 Region: 18-112
Classification Level Classification E-value
Superfamily LCCL domain 2.09e-27
Family LCCL domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000118990   Gene: ENSDARG00000063631   Transcript: ENSDART00000137398
Sequence length 762
Comment pep:novel chromosome:Zv9:13:242865:266946:-1 gene:ENSDARG00000063631 transcript:ENSDART00000137398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSAAKPNGKSKKAKQVVPAVDCDMRAGKVNLPEFMVKCPANCRETKEKVYGTGVFASISS
ICNAAIHSGVITNSGGKVIVAKTAGQAIYKGSFANGVRSLSLPTWRESFSVSVGKPKKGV
TYPSTLVFVTSRPSSGKTGESKDLPYTTASLVTEAAEAEPSTTTTPPTTTTTTTTTPPTT
TTPTTTSAKPRATVHRVREAGSSHPYFSSLARVQRPEMSATVRRQPAPSAPASGAYSRGQ
PPSERKQHTPQSNPVFARRDWTHPSYARPDWFSGSRRPTDSSQSVPNTGYKWSRTSSGDP
AVFDPVPDRTEYEHWPHNNQQFSPESEENKPVPETSHTRETPAESNPFESGFTSRVMDTT
ARAPEVPSQGDPNCKVDMAFLMDGSWSIGKRRFKIQKDFLVEVSQALNVGVAGAMMGIIQ
YGDDPVTEFSLKQFSNSKDLKPAISKIVQKGGPSHVGKALSYINKQFFSDANGNRGGAPN
VAVVLVDGWPTDRVEEASRLARESGINIFFVTIEGPDDNEKQNVVESNFVDKAVCRTNGF
FSLPIASWFALRKAVQPLVKRVCDTDRLVCSKTCLNANDIAFVIDGSSSVGTGNFRTVLQ
FVANVTREFEISDTDTRVGIVQYTYEQRLEFAFGQHNNKADLLNAIKRINYWSGGTSTGA
AITYAADQLFSKSKPNKRKIMIVITDGRSYDDVRAPALAVHRTGVIAYSIGIAWAAQDEL
EYIATDPDREHSFFVDEFDNLYKYVSKIIHNICNEFNSQPRN
Download sequence
Identical sequences F1Q7N1
ENSDARP00000118990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]