SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000119209 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000119209
Domain Number 1 Region: 25-80
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.15e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000119209   Gene: ENSDARG00000092160   Transcript: ENSDART00000143231
Sequence length 81
Comment pep:novel chromosome:Zv9:19:2463510:2463753:-1 gene:ENSDARG00000092160 transcript:ENSDART00000143231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSTGSPEIAVNMKPKRKRVISTVQRQAANIRERKRMFSLNEAFDRLRRRVPTFAYEKRL
SRIETLRLAIVYIAFMTDILE
Download sequence
Identical sequences F1R7I0
ENSDARP00000119209 ENSDARP00000119209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]