SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000119234 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000119234
Domain Number 1 Region: 168-205
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000945
Family HLH, helix-loop-helix DNA-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000119234   Gene: ENSDARG00000041689   Transcript: ENSDART00000132373
Sequence length 205
Comment pep:putative chromosome:Zv9:15:20214259:20219966:1 gene:ENSDARG00000041689 transcript:ENSDART00000132373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGQPKSSEPDVSVPVIEEGAVATAEDPSAITTIQSASTFSTDQPIKYLFKTEGAGGQVT
YRVIQVADGQLEAQPDGTTAVSVVTGFPATTQPVTQAVFSQSEGLEGDGTETHYTYYPAT
ISDATAGTMVTGVQASDALLSQSASAGQLYVMMSPQEVLTGANQSKSEGPRTSRDEKRRA
QHNEVERRRRDKINNWIVQLSKTIP
Download sequence
Identical sequences E9QFN2
ENSDARP00000119234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]