SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000119453 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000119453
Domain Number 1 Region: 190-420
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.28e-78
Family Eukaryotic proteases 0.00000954
Further Details:      
 
Domain Number 2 Region: 39-100
Classification Level Classification E-value
Superfamily GLA-domain 6.06e-21
Family GLA-domain 0.00037
Further Details:      
 
Domain Number 3 Region: 127-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000514
Family EGF-type module 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000119453
Domain Number - Region: 92-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00257
Family EGF-type module 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000119453   Gene: ENSDARG00000093079   Transcript: ENSDART00000132496
Sequence length 427
Comment pep:known_by_projection chromosome:Zv9:2:5110275:5118311:-1 gene:ENSDARG00000093079 transcript:ENSDART00000132496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLFFCALTLVVFCSDGALCKSVFSSSPNAHMLLRSRRANTFMEELKPASLERECREEL
CDFEEAREIFITREATLEFWTAYKDGNQCTTNPCVHGKCVDLLQDFSCTCDSGFEGKHCD
LRRTATNCSLNNGDCDHDCHESKDGLARTCSCIKGYQLQDNSRKCTPKNDASCGQIRIQK
SAYLQPCGFAYRVGKRGKSPWQALILNNLGRFHCGGVLIDENWVLTAAHCLETSSKFSVR
LGDYQRFRFEGSEITLPVKQHISHPQYNPITVDNDIALLRLEVPAKFSTYILPACLPSLE
LAERMLHRNGTVTVITGWGKDNQSATSYNSMLNYVELPIVDNKECSRHMMNNLSDNMLCA
GVLGQVKDACEVDSGGPMMTLFHHTWFLVGLVSWGEGCGQRDKLGIYTKVASYLDWIDSV
RQGWDKV
Download sequence
Identical sequences B8JLG2
ENSDARP00000119453 ENSDARP00000119453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]