SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000120259 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000120259
Domain Number 1 Region: 62-181
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 4.71e-34
Family Ypt/Rab-GAP domain of gyp1p 0.0067
Further Details:      
 
Domain Number 2 Region: 157-279
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.85e-29
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000120259   Gene: ENSDARG00000075376   Transcript: ENSDART00000142278
Sequence length 287
Comment pep:known_by_projection chromosome:Zv9:10:1694804:1702060:1 gene:ENSDARG00000075376 transcript:ENSDART00000142278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMGMPALELCMEPGVNTTPEGTDSALSEEEPEMDNLFPKPDSLAVTGDKNDIASPVSSIG
TTYSQELVDLYTLNLHRIDKDVQRCDRNYWYFTPANLEKLRNIMCSYVWQHLDIGYVQGM
CDLLAPLLVILDDEAMAFSCFTELMKRMNQNFPHGGAMDTHFANMRSLIQILDSELFELM
QQNGDYTHFYFCYRWFLLDFKREMVYDDVFSVWETIWAARYASSEHFVLFIALALVELYR
DIILENNMDFTDIIKFFNEMAERHDVPKLLVMARDLVHKVQILIENK
Download sequence
Identical sequences F1QCN4
ENSDARP00000120259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]