SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000120694 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000120694
Domain Number 1 Region: 81-164
Classification Level Classification E-value
Superfamily E set domains 2.33e-20
Family E-set domains of sugar-utilizing enzymes 0.08
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000120694
Domain Number - Region: 171-220
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00093
Family HLH, helix-loop-helix DNA-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000120694   Gene: ENSDARG00000016116   Transcript: ENSDART00000134114
Sequence length 335
Comment pep:novel chromosome:Zv9:14:36323322:36391249:1 gene:ENSDARG00000016116 transcript:ENSDART00000134114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSRFFLKFFLKCNQNCLKNAGNPRDMRRFQVVVSTTVSVDGHVLAVSDNMFVHNNSKHG
RRARRLDPSEGTPSYLEHATPCIKAISPSEGWTTGGATVIIIGDNFFDGLQVIFGTMLVW
SELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGTPGRFIYTALNEPTIDYGFQRLQK
VIPRHPGDPERLPKEVILKRAADLVEALYGMPHNNQEIILKRAADIAEALYNVPRGHNQL
PGLTNSSVHSGMMGVNSFHSQLAVNVSDSTQAANQGFSRNTSSVSPHGYVPSTTPQQSSY
STVSTSMNGYGNAGMTTLGGSPNFLNGSAANSPYA
Download sequence
Identical sequences ENSDARP00000120694 7955.ENSDARP00000028095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]