SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121030 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000121030
Domain Number 1 Region: 188-254
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-18
Family LIM domain 0.0046
Further Details:      
 
Domain Number 2 Region: 129-192
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.5e-17
Family LIM domain 0.0017
Further Details:      
 
Domain Number 3 Region: 67-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000228
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 7-72
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000015
Family LIM domain 0.014
Further Details:      
 
Domain Number 5 Region: 250-278
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000285
Family LIM domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121030   Gene: ENSDARG00000034643   Transcript: ENSDART00000143757
Sequence length 279
Comment pep:known chromosome:Zv9:16:35969551:36050492:1 gene:ENSDARG00000034643 transcript:ENSDART00000143757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERFDCDNCKESLYGRKYIQAEENPYCIPCYDSLFANTCDECKELIGHDSRELFYEDRH
YHEHCFRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVACDKTVMPGTRKLEYAGS
TWHEGCFICNSCQQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQALAKGGVTYRDEP
WHKECFVCTSCKVQLAGQHFTSRDDSPYCIKCFGNLYAKKCEACNKPITGFGGGKYISFE
DRQWHQPCFTCSRCSVSLVGAGFFPEQDEILCRNCNSTL
Download sequence
Identical sequences E7EZP9
ENSDARP00000050172 ENSDARP00000050172 ENSDARP00000121030 XP_021322623.1.45394 XP_021330031.1.45394 XP_021330032.1.45394 XP_695478.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]