SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121833 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000121833
Domain Number - Region: 362-406
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0323
Family Chromo domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121833   Gene: ENSDARG00000093846   Transcript: ENSDART00000144513
Sequence length 407
Comment pep:known chromosome:Zv9:4:34187912:34199330:-1 gene:ENSDARG00000093846 transcript:ENSDART00000144513 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSTGERSVQTQRKTPAEATDLHTVIKMAFIKEESEDVKIEETFTIKQEDLQEQTERTKKP
KQKPCHNCGALNVSNCKTCRNCFAAIALKAIIMAKQKNIEESSWAANNKKHRNSARVVDS
ARTAVKKLEMLGYKPLLFISKEKKKGFNAELITTMGPFGEGPQQKIIDKMTSLYEVFIKN
FQRFQNLAATDPDVCQNLPSSVSPPASIPPSSFSSLPPPPSFPNLSPPQTSSSFSPSSAV
LLPSFPNLPPPQSSSSFPPSSAPPSLSSNLIPPTNSSSFSPPTSSYITPLPPASSYKTLL
APPPTSLTTTPTSSLSSPAVQCMTTDSGDSADLSSRESVIKGGKQKKWIYKQAECQVHSN
QKTFPYDRIVKRRMSKEGVEEARVRWKPCSGCGMKWKDSWEPLNHFL
Download sequence
Identical sequences F1R811
ENSDARP00000121833 ENSDARP00000121833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]