SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121850 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000121850
Domain Number 1 Region: 443-617
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.88e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 
Domain Number 2 Region: 595-732
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.28e-17
Family Ypt/Rab-GAP domain of gyp1p 0.024
Further Details:      
 
Domain Number 3 Region: 761-900
Classification Level Classification E-value
Superfamily EF-hand 5.66e-16
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121850   Gene: ENSDARG00000062192   Transcript: ENSDART00000135153
Sequence length 1108
Comment pep:known_by_projection chromosome:Zv9:5:25310768:25344157:-1 gene:ENSDARG00000062192 transcript:ENSDART00000135153 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLKPEEVLLKNALKLWVTEKSNDYFVLQRRRGYGEDSGGLTGLLVGTLDTVLDSTAKVA
PFRILHQTPDSQVYWTIACGASLEEISQHWDWLQQNIVRTLSVFDSGEDITSFVQGKIRG
LIAEEGTSAGDEEDPERFREAVLRFERLFGLPQREKLVTYFSCSYWRGRVPNQGWIYLST
NFLCFYSYMLGNEVKLVYPWDEVSRLERTSSVLLAESIRVRVRGEDHFFSMLLRLQQTYL
IMQQLADYAIVRFFDKETFHAEHPLANPLHITQRALEIHARNQSFRSFFRLPQEENLCEV
YESFLWVPFSHVNTLGKICVSENYLCFASQDGSQCHLIIPLWEVFSVELPDRSSRALTVC
LRGKRALRFSEVRDFERLAATIRRKCGTLGSPQHCITNPDEEGVMVGQSQAVSTEALMNV
FHPHDAENLDPKMLKERMKEQSWQIHFAEYGRGTGMFCTKKTRDLIVRGVPETLRGELWM
LFSGAVHDMISHPGYYGRLLEDCMGSSSLACDEIERDLHRSLPEHPAFQSDTGISALRRV
LTAYAHRNPKIGYCQAMNILTSVLLLYAKEEEAFWLLVAVCERMLPDYFNRRIIGALVDQ
AVFEELIREHLTQLTEHMTDLSFFSSVSLSWFLTLFISVLPIESAVNVVDCFFYDGIKAI
LQLGLAVLDYNMDNLLCCNDDAEAVTVLNRFFDSVTNKDSPLPATVQQASATANDKSIQK
VDISDLIKEAYEKYGDIRTEEVENMRKRNKLYVIQTLEDTTKQNVLRVVAQDVKFSASQL
DELYLLFKNHDPSLPYLDQYQLDQSQFSSLFNLLQPWTTHTHSRSLARSAFHLLDENGDG
LVNFKEFICGLDILYNRSFTEKLKLLFKLHLQPDSAEDGVIRKCPERGRAKVDLQEYLKQ
WQEDLQRREENIKDLPRINQVQFISLTKTLYSVFHGDEEEESLYRAVARVTSLLLRMEEV
GRKLQDSSPQKTPQTTPTSTSQPESSPTKPTSPESETPAESRSTHDQPESPVSQHETAPS
HSDITPNSTSHPSTPTSSPTETSSPVLDTPTDTPSSPCTVRDGDWSFSFEQILASLLNEP
SVVRFFERVVNTDTLITRARKNQLKDAH
Download sequence
Identical sequences B0R0W9
7955.ENSDARP00000084038 NP_001120987.1.45394 ENSDARP00000121850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]