SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000121910 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000121910
Domain Number 1 Region: 24-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000824
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000121910   Gene: ENSDARG00000074897   Transcript: ENSDART00000143321
Sequence length 150
Comment pep:novel chromosome:Zv9:8:49077472:49082398:-1 gene:ENSDARG00000074897 transcript:ENSDART00000143321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPNIITEAHPHSFGSRMTVAQRKEAHELRKTLKPLMEKRRRARINDSLNHLKTLILPLV
GKDASRYSKLEKADILEMTVRFLRDLPSSSAKGQTDSYKEGYKACLQRISTMLPQSNLET
EAHQRVSEFIHTRWRLLHRPARTAVLRTQK
Download sequence
Identical sequences B0V2G6
ENSDARP00000121910 NP_001116717.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]