SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122022 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122022
Domain Number 1 Region: 295-405
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.31e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0036
Further Details:      
 
Domain Number 2 Region: 76-211,239-257
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122022   Gene: ENSDARG00000036212   Transcript: ENSDART00000140711
Sequence length 863
Comment pep:known chromosome:Zv9:19:20887051:20929053:-1 gene:ENSDARG00000036212 transcript:ENSDART00000140711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHPNFETRHPLQQDEQETGYDPLQNYNRNRDRGSLGSAVESTLQSYRKEWDDLFQNSNY
LPRIRQAGINGRLRSSRFRSVCWKLYLDVLPEDKAQWISRTKEHRAQYEKIKEMHITNPR
KAAGQQDLVVNNPLSQDEGSLWNKFFQDKELRGMIKQDVLRTFPEMLYFQEEDVRTKMTD
ILFCYARENEQLLYKQGMHELLAPIVFVLHCDHQAFQHASETANPSDEMKVLLDPKFHEH
DAYTMFSLLMETAEPWFSSFEREVRKGKEEMLTSIPFARPQDSGPSVAIVTKVNRIQDQL
IKKHDIELYMHLNRLEIAPQIYGIRWVRLLFGREFPLQDLLVVWDALFADSITLDLVDYV
FVAMLLYIRDALIASNFQTCLGLLMHYPPIGDIHSLLLKALFLRDPKNNPRPVNYQFQQN
LDYYKTRGADLVNKTRASTKAAPLNINKVSSSLLNFGRKLIAPMGGGSGGISPINSEVLS
APPLPAPASRPLTEAPSCPAPLNTQMKSQPLPQTQHQHRLLKSESMPVHLSKDVGSCGAS
QISLPAQIHSDITGHSSRTVSSSPSTESLSCSRDHAMSSPPLPVSRGRDSSTSSPPSSAT
KKDSFFNISRSRSHSKTINKKDAEELEAQVSFLQGQINDLEAMSKYCAKMMNAHIGKIQD
VILQEHLEKEDEVLVSLAGLKQIKDILKGALRFNQSQLESEDNEEITIADDHYCSSQYST
LKYYSDFVHQSADNDADADASRQQTQQLDDHEEVDGMADKEEELQEVEEKVLTTKNVPMT
PELQASEGRNWDDYILVSKDGEPSGNEEQSGTPTAPLFKNVRALNKADFQDPLMGTTSGS
SSPDDGSTHSKDSDFTIVNPTDL
Download sequence
Identical sequences J9JI17
NP_001315187.1.45394 ENSDARP00000122022 ENSDARP00000122022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]