SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122112 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122112
Domain Number 1 Region: 221-489
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.98e-113
Family N-acetyl transferase, NAT 0.000000000118
Further Details:      
 
Domain Number 2 Region: 91-219
Classification Level Classification E-value
Superfamily Chromo domain-like 1.1e-34
Family Chromo barrel domain 0.00000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122112   Gene: ENSDARG00000027187   Transcript: ENSDART00000140290
Sequence length 502
Comment pep:known chromosome:Zv9:3:32818250:32825568:1 gene:ENSDARG00000027187 transcript:ENSDART00000140290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGAAMSMSNSRHPNMNNSYENCGSEERMDVEIDSGHAGTDRGRLETGTRATCSSNGSGG
EEDEMEAADREREATGSSTPRSADGVSLGGGREQEVSVEIGETYLCQRTDKTWHSAEVIQ
SRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELVDQPER
KITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDAWYFSP
FPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEVDGKDH
KIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDGNNVAC
ILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDF
RGTLSIKDLSQMTSITQSDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPI
TVDTHCLKWAPPKHKQAKFSKK
Download sequence
Identical sequences F1QX50
ENSDARP00000122112 ENSDARP00000122112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]