SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122217 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122217
Domain Number 1 Region: 790-1086
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.86e-67
Family Tandem AAA-ATPase domain 0.0000373
Further Details:      
 
Domain Number 2 Region: 516-788
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.83e-58
Family Tandem AAA-ATPase domain 0.0000325
Further Details:      
 
Domain Number 3 Region: 2054-2127
Classification Level Classification E-value
Superfamily BRK domain-like 1.96e-16
Family BRK domain-like 0.00025
Further Details:      
 
Domain Number 4 Region: 396-459
Classification Level Classification E-value
Superfamily Chromo domain-like 0.000000000000378
Family Chromo domain 0.05
Further Details:      
 
Domain Number 5 Region: 466-533
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000000000255
Family Chromo domain 0.0067
Further Details:      
 
Domain Number 6 Region: 2009-2047
Classification Level Classification E-value
Superfamily BRK domain-like 0.0000262
Family BRK domain-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122217   Gene: ENSDARG00000075543   Transcript: ENSDART00000131837
Sequence length 2231
Comment pep:novel chromosome:Zv9:2:37790283:37817128:-1 gene:ENSDARG00000075543 transcript:ENSDART00000131837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XITLVLQQPSQGGAAQAGTVTVGGTAGSGQQGQQPRLVLGSLPGKLVLQGDQLAALAQAK
AGQTGAQAKVLTIQLQVQQQPNQQGAKFQLVSGAANAGGSPQVVQISQGQGGQRLAVPLK
LLLQPQSNTVSSAGGAVSVVKVINTSAAGSTSGTTTTAASSGVRLAKIQEPVRRVETLCK
QEKANRIVAEAIARAKARGERNIPRVLNQDELPAGQTSADLEGAGGATGAKKKGGGGVGG
GGGGSKKKSPSAGGAKMVVGGDKKSKAKTPVIPGGGSKSKSKTKLNTITLVGKKRKRNPS
SDHSDVDLSPPVSPRTLEEEMSQKRRSNRQVKRKKYTEDLDIKITDDEDELDADVDVTTT
PMPAVGHVQPLGAELPPELDGDGLPSMQFFVENPSEEDAAIVDKILSMRVTKKEARQYTN
VEEFFVKYKNYSYMHCEWASLEQLERDKRIHQKLKRFKTKQAQMRNLFQEDEEPFNPDYV
EVDRILDESHSVDKDNGEPVVYYLVKWCSLPYEDATWELKEDVDEGKVEEFRKIESRQPR
LKRTPRPAASAWKKLDESTEYKNGNQLREYQLEGVNWLLFNWYNRQNCILADEMGLGKTI
QSIALLSEMFSAGVQSPFMIIAPLSTITNWEREFSNWTDMNAIVYHGSLASRQMIQQYEM
YCKDDKGHLIPGAYKFDALITTFEMILSDCPELREISWRCVVIDEAHRLKNRNCKLLDSL
KMLEIEHKVLLTGTPLQNTVEELFSLLHFLEPAQFPSEIEFLREFGDLKTEEQVQKLQSI
LKPMMLRRLKEDVEKNLAPKQETIIEVELTDVQKKYYRAILERNFSFLSMGATQNSNVPN
LLNTMMELRKCCNHPYLITGAEEKIVSELREVYDPLAPDFHLQALVRSAGKLVLLDKLLP
RLKAGGHKVLIFSQMVRCLDILEDYLIHKRYLYERIDGRVRGNLRQAAIDRFSKPDSDRF
VFLLCTRAGGLGINLTAADTCVIFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSY
EREMLDKASLKLGLDRAVLQSMSGNKESSIQQFSKKEIEDLLRKGAYAAIMDENDEGSRF
CEEDIDQILQRRATTITIESEGKGSTFSKASFVASENRTDIALDDPEFWQKWAKKADIDM
DSLNRKNTLVIDTPRVRKQTRQFSSLRGEGGDLSDLDSDDDYPPHNSRQSRASRRSDRHS
GGGYGRTDCFRVEKHLLVYGWGRWRDILSHARCKRRLSERDVETICRVILVFCLIHYRGD
ENIKSFIWELITPPENGREPQALLNHSGLSIPVPRGRKGKRVKAQSSFDVQKVEWIRKYN
PDSLLLDDSYRKHLKHQCNKVLLRVRMLYYLKQEVIGEHADSVLSGADARDIDIWLPEME
QQDVPSGWWDAEADRCLLIGVYKHGYEMYTTMRADPCLCFVERCGRPNEQDINAEQQAAD
PELGEGGDYDKYSEDPEFKPATRHAKEMYEEGDSVNADGEICVEDRSAPMQVEGPSSGSS
DLCYWPTSSSLTARLRRLITAYQRSYRREQLKIEAAEKGDRRRRRCEQATKLKEIARQER
QQRWTRREECDFYRVVSTFGVERIKKETDAPEGDEHHMDWNRFRSFARLDKKTDESLTRY
FKCFMSMCRKVCHIRPGRGDESQDMSQSLAPITEERASRTLYRVTLLCRLRERVLPHPSL
EERLSLAPQTSDLPSWWSIPKHDHELLLAAARHGVSRTELSIFSDPLYSFSQSRLDYLQN
QQAQAAAQIHAFSQSQDPAGIKEEGLEDESRLLGVEALCPSDSPAMLLSHSDSKVGIQAG
WVWKKSKNNGPSERKLGGGGGGASDSDSDSDSGSSSSSRHSGSSDDSGDSDVEREQAALK
MCDGDEENSILSLTPSQEGAPPESLTDPLRVDWPKDRILINRIENLCSLVITGHWPSGRR
YISDIQLNTVSDEHELGDDLGYSRVARKINSTLSAEALEGQESEFTVKLLKEEGLKLTFS
KQALMPNGEGSARKKRKDHELEDAEGVLHAPRRRDLPNWLKENPDYEVEGDMLELLVNRT
KRKRRRKRVEKGAALTGSERVKVIDIRTGKKFAGVFGPALQDLREHLEENPDHAVAPEWS
ETVRHSGFLPEILFHRLLSPHASIPKKSRHYLHTPSLQTDDPLLGGGEGEMLVSDGAYMM
DDEDLEDGGHLTSSHHFLTPAYDVKMEPSALDMDGGDSLSQGGYDSSDREAILDDVIMAP
KHSDTSSSSED
Download sequence
Identical sequences F1QW70
ENSDARP00000122217 ENSDARP00000122217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]