SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122274 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDARP00000122274
Domain Number - Region: 284-311
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 0.0876
Family Skp1 dimerisation domain-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122274   Gene: ENSDARG00000074031   Transcript: ENSDART00000145378
Sequence length 568
Comment pep:novel chromosome:Zv9:1:5089153:5104178:1 gene:ENSDARG00000074031 transcript:ENSDART00000145378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVYKSGLDMLRLALKSTSPWKCDSFIRTQASSCYKIISIVASPQLGRKNTHSFKQIRFY
SQHSSQDAVDLQVKQTTEAFEVSDQADSTPFSAHLQKCSCPTDVLDAVKQFPASQNDLSS
IFSRMRESTKKMTAEQQRCELQLMFEHPGFREVCERVVSDAWRMRCDDLAYTLLAIINLG
VSQHTRIVQTLLRVVQERLNQFDNRSLSVLAAGIQQMENGNNVQALREALGLLLKDRVPE
ISNVVVLQNMMRAMGKNSPKELKMQLAIKTLSLADEFSPPNTQYVFLSLAAMDLNFKPLL
NICSKNIAENVHEFPISRLVMVLKSCYELQYRNYSLFSSISEYMTNTFDMWSNKKVILLL
LTFEDLYFRPVHLLDAFAERIIQKPDSLTLKDLLSVLKVFSMLNHDLKERKTEFLDCITE
VLESYLPKMTPSELLKVNYYLALMEHFHQMLLDKLMQQETLEQLLQTDKPSIKVLRWLHT
IDLCLQLDKPQLPSFTSSKPLNITVPAFEATANQEMLSAVRSIVGTHAVQDSVLEQSIYF
IDCVITLPGEKVETCGLHEDCGSPECNQ
Download sequence
Identical sequences B8A452
7955.ENSDARP00000100864 ENSDARP00000122274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]