SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122451 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122451
Domain Number 1 Region: 4-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000116
Family HLH, helix-loop-helix DNA-binding domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122451   Gene: ENSDARG00000013789   Transcript: ENSDART00000141639
Sequence length 74
Comment pep:known chromosome:Zv9:4:705865:717478:-1 gene:ENSDARG00000013789 transcript:ENSDART00000141639 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MKEKSKTAARTRREKENSEFYELAKMLPLPSAITSQLDKASIIRLTSSYLKMRLVFPQGV
GSSGANQIWRKPIP
Download sequence
Identical sequences E9QGS8
ENSDARP00000122451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]