SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122768 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122768
Domain Number 1 Region: 18-74
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000122768
Domain Number - Region: 82-119
Classification Level Classification E-value
Superfamily Orange domain-like 0.0196
Family Hairy Orange domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122768   Gene: ENSDARG00000094426   Transcript: ENSDART00000137573
Sequence length 152
Comment pep:novel chromosome:Zv9:23:21749296:21751084:1 gene:ENSDARG00000094426 transcript:ENSDART00000137573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPTITGSISSRETLLTNKLRKPMVEKIRRERINSSIEKLKTLLAQEFIKQQPDSRQEKA
DILEMTLDFLRRSQKSSAAGDGRSRCVQEAVSFLSQCPVQTQSHTRLMKLFLHMQTPADQ
HTRVDNPQTTETHANSSAKQHTPARSHIWRPW
Download sequence
Identical sequences B0V3D1
ENSDARP00000122768 ENSDARP00000122768 NP_001154881.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]