SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122813 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122813
Domain Number 1 Region: 1171-1266
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 0.0000000186
Family Ypt/Rab-GAP domain of gyp1p 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122813   Gene: ENSDARG00000041734   Transcript: ENSDART00000144401
Sequence length 1298
Comment pep:known chromosome:Zv9:20:40798376:40872724:1 gene:ENSDARG00000041734 transcript:ENSDART00000144401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFSTEDEAELQTLLRKLLKSVKDRISGAPSVECAEEILLHLEETDKNFHNYEFVKYLR
EYVESSLGAVIEVETENFTKGEGHAVGSGQDTLVHAVTKNTRESTQYKQMMQTLKQTMMM
VVESLINKFEEDQMKREEMDRKIQHQQSISQYADNCSDSDSSFNQSYAFIKHEQLQVIAE
KLDPGRPREVRWEALQSLCHAPPSDVLSCESWTGLRRNLSTALTDPDPELSDKVLQFFAK
TFSSSPLNVTKDIYASIGNTKTLEAHFLYHKLSFPSGTTSIDANRPDMARLLKQMRLMND
FQKEVTTFWIRHPEKYMEEIIENTLSLLALHSEQGMSSPGSEKSLEPIHLISLLDIKATW
FKKWMHGYYSRTVVLRLLERKYKSLIVNALQQCIYYFDSCDALSEETLEMIHSLEHQQIG
PAGRTLYTSKELEFVYFVHSLCVLGRLVMYTNGRKFFPIKVKKRRDPVTLTDLVVILINI
MYQHPKPSCGETALADTMSPTNLVMEVLRTLCDRTECAVECLYQIPVIETLLAPLITLLT
GKLPKLNSMESALTHTADTLARIATTERGLSLLLYDRNLVSAEGESISAAHLIVQFTQKL
LAKELQVENSSSMSGAFIFVCRQMYNTCEGLQVLRPYSLHECIAQAWRTTSSMSERVPTP
VPGAPPALASQELQSVVAWEEMLLDNLLNFAATPKGLLLLQQTGAINECVTYMFSRFTKK
LQVSRCEKFGYGVMVTQVATTAPGIVALQSSGFVQTIVVELWSALECGREDVRVVHPKST
PMDPIDRSCLKSFLSLVNLLSSPHAVWELLGHRALPNKTEYNLREMATSVLDLMDRLIII
NSDAKIHSLFNYEQSHTFGLRLLSVLCCNLDSFLLLESQYKLTDLLLQGQRDNVTEPPSG
EGEFIIDGLSVERNHILVRICAVGGPSERKLPPRALQKGNDPYPWPMVSTYPLPKYYIFD
VPKILRTKQESEIGAFLTSSKETERDASWMDDCRRQFCKIMATKSNTLTGYVLADLLEMV
VLHLSSSSNDCFFPPAEYKVVDNSVKTRSLSSVEQLGVEISLRYGKFLKLLREDSEQDLC
LLLKHCQEFLSQQRVKVTSELCGYPGHDWFASTVFLLMHGDVGRSLSLLLRFSRLLPSAF
LWPPRLHSSVHLPIEIAQSAIHPIYSCTAHYVEMLLKAEVPLVFSAFRMSGFTPSQICVQ
WLGQCFWNYLDWPEICQYVTTCVIMGPDYQVYMCVSALRHLQQDILQHTQTQDLQVFLKE
EPIQGFRVSNYLEYMEGLERSYRSMVLSDMRSILPRSS
Download sequence
Identical sequences Q5RHR6
ENSDARP00000061167 ENSDARP00000122813 NP_001093493.1.45394 ENSDARP00000061167 7955.ENSDARP00000061167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]