SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122819 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122819
Domain Number 1 Region: 131-189
Classification Level Classification E-value
Superfamily Chromo domain-like 5.5e-24
Family Chromo domain 0.000063
Further Details:      
 
Domain Number 2 Region: 16-73
Classification Level Classification E-value
Superfamily Chromo domain-like 2.32e-21
Family Chromo domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122819   Gene: ENSDARG00000061187   Transcript: ENSDART00000147598
Sequence length 189
Comment pep:known chromosome:Zv9:23:36350779:36357418:-1 gene:ENSDARG00000061187 transcript:ENSDART00000147598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKSQNREDDEAASSDEEEYVVEKVLDRRVVKGRVEYFLKWKGFTEKHNTWEPEKNLDC
PELISEFMKTYKKGNSASPPSSKSSSTGPSSARPKDSSGSSSTSKRKNSEEENGSSSKPK
KKKEDEILVARGFERGLEPEKIIGATDSCGDLMFLMKWKDSDEADLVLAKEANHKCPQIV
IAFYEERLT
Download sequence
Identical sequences E9QFQ7
ENSDARP00000122819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]