SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122834 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122834
Domain Number 1 Region: 110-187
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 6.8e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122834   Gene: ENSDARG00000041689   Transcript: ENSDART00000142902
Sequence length 230
Comment pep:putative chromosome:Zv9:15:20216442:20222562:1 gene:ENSDARG00000041689 transcript:ENSDART00000142902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XTYRVIQVADGQLEAQPDGTTAVSVVTGFPATTQPVTQAVFSQSEGLEGDGTETHYTYYP
ATISDATAGTMVTGVQASDALLSQSASAGQLYVMMSPQEVLTGANQSKSEGPRTSRDEKR
RAQHNEVERRRRDKINNWIVQLSKTIPDCTIDSTKTGQSKGGILSKACDYIQELRQSNSR
LGDELNSIERLRMDNQLLRQEVEDWKSKNQILRNQLRQHGIVAAASADPQ
Download sequence
Identical sequences F1QQW3
ENSDARP00000122834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]