SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000122878 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000122878
Domain Number 1 Region: 42-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000641
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000122878   Gene: ENSDARG00000055283   Transcript: ENSDART00000137090
Sequence length 137
Comment pep:known chromosome:Zv9:17:34973027:34974349:1 gene:ENSDARG00000055283 transcript:ENSDART00000137090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAISPVRSFRKSSASVTTTEHSLGISRSKTPVDDPLSLLYNMNDCYSKLKELVPSIPQN
KNVSKMEILQHVIDYILDLQIALDSNSAITSLHHPRAGQGTSRTPLTTLNTDISILSLQT
PEFPSDLITEDSRTLYR
Download sequence
Identical sequences Q7SZQ2
ENSDARP00000072092 ENSDARP00000122878 ENSDARP00000072092 NP_958448.1.45394 7955.ENSDARP00000072092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]