SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123074 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123074
Domain Number 1 Region: 128-191
Classification Level Classification E-value
Superfamily Chromo domain-like 3.88e-20
Family Chromo domain 0.00036
Further Details:      
 
Domain Number 2 Region: 14-70
Classification Level Classification E-value
Superfamily Chromo domain-like 5.64e-20
Family Chromo domain 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSDARP00000123074
Domain Number - Region: 77-130
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.0471
Family A middle domain of Talin 1 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123074   Gene: ENSDARG00000092158   Transcript: ENSDART00000131582
Sequence length 194
Comment pep:novel chromosome:Zv9:16:23122950:23132302:-1 gene:ENSDARG00000092158 transcript:ENSDART00000131582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKKQNVKNRKAEETTVVQEFAVEKIIRRRVNNGKVEYYLKWKGFTDAENTWEPEDNLDC
PELIEEYLRNLTVLGQETEQEECQSLDHEVQPKEELSELAADMAHQQPQEELIERTNEEV
EEHNAEIPVGQPGHPEPDCIIGCTDQQGELMFLIKWKNTDEVALLAAVEASKRWPQMVIR
FYEDKLTWHGDDEQ
Download sequence
Identical sequences E9QDB7
ENSDARP00000115213 XP_709202.1.45394 ENSDARP00000115213 ENSDARP00000123074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]