SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123237 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123237
Domain Number 1 Region: 253-529
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 2.57e-112
Family N-acetyl transferase, NAT 0.0000000295
Further Details:      
 
Domain Number 2 Region: 3-97
Classification Level Classification E-value
Superfamily Chromo domain-like 6.59e-23
Family Chromo barrel domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123237   Gene: ENSDARG00000045951   Transcript: ENSDART00000132183
Sequence length 538
Comment pep:known chromosome:Zv9:5:69729001:69745247:-1 gene:ENSDARG00000045951 transcript:ENSDART00000132183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPTVEIVEGCRLPVLRKNQENEDEWPLAEILSVKDIPGRKLYYVHYIDFNKRLDEWVT
PDRLDLKKLQFPKKEAKTPTKNGLPGSRPSSPEREVRKSLDLNVQSASAPSRGKTLPTPK
RKAESVSLATQVTAATPVPSLPSSAEASQASVYPAMRDSSFSIKAREEHEQLTSLTTNGT
TRRLIPSQPGRKRKNCVGTEEIVKVFQNNSPRSSTVYLPPGEDSQDSSDGIPSAPRMTGS
LVSDRSHDDIITRMKNIDCIELGRHRLKPWYFSPYPQELTTLPILYLCEFCLKYLKSLKC
LQRHLTKCNLRHPPGNEIYRKGTISFFEIDGRKNKMYSQNLCLLAKCFLDHKTLYYDTDP
FLFYVMTEYDSKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKV
EGKTGTPEKPLSDLGLLSYRSYWSQTILEILMNLKSENGERPQMTINEISEITSVKKEDV
ISTLQYLNLINYYKGQYILTLSEDIVEGHERAMHKRHLRIDSKCLHFTPKDWSKRGKW
Download sequence
Identical sequences B8JKI8
ENSDARP00000030282 ENSDARP00000123237 7955.ENSDARP00000030282 NP_001013327.2.45394 ENSDARP00000030282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]