SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDARP00000123627 from Danio rerio 76_9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDARP00000123627
Domain Number 1 Region: 22-84
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDARP00000123627   Gene: ENSDARG00000008796   Transcript: ENSDART00000145336
Sequence length 227
Comment pep:known chromosome:Zv9:14:31412619:31414295:1 gene:ENSDARG00000008796 transcript:ENSDART00000145336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKISDWKEGIHKMSEPTAETPMEQKDMRRVPKPLMEKRRRDRINQSLETLRMLLLENTN
NEKLKNPKVEKAEILESVVHFLRAEQASETDPFQITRVKRARTEESDEDVESPCKRQSYH
DGMRTCLLRVSNFITGKSHEFGQELEKACENIHKSHSRQVQLLSTPSRIETQVHLYEDPS
QQHLAHVQLSNSCTPSGCSKLAQRTVPAMTSSPKQPVMLCDPVWRPW
Download sequence
Identical sequences ENSDARP00000123627 ENSDARP00000123627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]